PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI12G02540.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 281aa    MW: 30860.7 Da    PI: 4.8949
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI12G02540.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS73.73.3e-23177273277373
             GRAS 277 reseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsv 370
                      + s+ r+++Er +l+r++v v+a egaer+er et+++W++r ++aG+++v+++ ++++ +++ +r+ + +++ +ee+ g+l++gWk+r L++ 
  ORUFI12G02540.1 177 AGSHLRAVLERDVLRRAAVGVIAGEGAERVERPETYRRWQARNRRAGLRQVAVEADVVEAVRRRVRRRHHEEFVIEEDAGWLLQGWKGRILYAH 270
                      4578899**************************************************************999********************** PP

             GRAS 371 SaW 373
                      SaW
  ORUFI12G02540.1 271 SAW 273
                      *** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS509859.981254IPR005202Transcription factor GRAS
PfamPF035141.2E-20177273IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MGPAAPPSEA AAAADDVVLP YISRILMEED IDDDMFFCLY PDHPALLEAQ QPFAQILSSS  60
SGIAGEVNSA PMEDSAALMM QGSGNGRGRK GSKHGGDELE AEVGRASKLM ATPEEEDDDD  120
DGVGEMLEKM MLNGDEEMNA PRVPAEKNGG KAARRKRRQG KGEVVDLREL LMSCAQAGSH  180
LRAVLERDVL RRAAVGVIAG EGAERVERPE TYRRWQARNR RAGLRQVAVE ADVVEAVRRR  240
VRRRHHEEFV IEEDAGWLLQ GWKGRILYAH SAWVVAEDGA H
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1069010.0AK106901.1 Oryza sativa Japonica Group cDNA clone:002-118-H08, full insert sequence.
GenBankAP0149680.0AP014968.1 Oryza sativa Japonica Group DNA, chromosome 12, cultivar: Nipponbare, complete sequence.
GenBankBX0005020.0BX000502.2 Oryza sativa chromosome 12, . BAC OSJNBb0041E01 of library OSJNBb from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
GenBankBX0005040.0BX000504.2 Oryza sativa chromosome 12, . BAC OJ1239_F07 of library Monsanto from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015619736.11e-102PREDICTED: scarecrow-like protein 30
TrEMBLA0A0E0RDH40.0A0A0E0RDH4_ORYRU; Uncharacterized protein
STRINGLOC_Os12g04200.11e-101(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59450.14e-11GRAS family protein